PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30857.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family HB-other
Protein Properties Length: 941aa    MW: 105176 Da    PI: 9.517
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30857.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.24.3e-0666122157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g++ +qV+ +F  ++++ +k
  KFK30857.1  66 KRPRDLLNPKAVKYLQAFFAIKDAISKKESREISALFGISVAQVREFFVTQKTRVRK 122
                 799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.63763123IPR001356Homeobox domain
SMARTSM003895.3E-565127IPR001356Homeobox domain
CDDcd000869.73E-466123No hitNo description
SuperFamilySSF466897.27E-666129IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-466131IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.102.4E-4230323IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476767.59E-5233325IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MDAFKEEIEI GSSVESLMEL LDSQKEIFHS QIDQLQDVVV MQCKLTGVNP LAQEMAAGAL  60
SIKIGKRPRD LLNPKAVKYL QAFFAIKDAI SKKESREISA LFGISVAQVR EFFVTQKTRV  120
RKQVRLSREK AIMSNTNGLL ENGVPESNGI NGTHIDPVPL NIAVAEPSSI SWSEGETVAP  180
MPQEDIPPDI SEADKYFVEN IFSLLRKEET FSGQVKLMEW MMQIQDSSVL IWFLSRGGVL  240
ILTTWLSQAA IEEQTSVLLL ILKVLCHLPL HKASPENMSA ILQSVNGLRF YRTSDISNRA  300
KGLLSRWTKL FAKIQAMKKQ NRNNSQIDSQ SQLLLKQSIA EIMDDNRNAE EILSLSNGRS  360
ENVRRIESSQ GPKLLLTSAD DSTKKHMLGA TSYNKERRKV QMVEQPGQKA AGRSPQTVRI  420
GTSGRSRPMS ADDIQKAKMR ALYMSKNTKK DPLPNAIGDS RTTVPEKPLA LQSAKDIVPE  480
KPLALQSAKD IVPEKPLALQ SAKDSPPTPS QTNEAKIEDT PEPSSLQAVN VPVQAEEYRK  540
PSTPPQTIAR KVAVLLKMSP QTILKNCKRK QIKWHVPPGM ELDELWRVAA GGNSKEADVQ  600
RNRNRRERET TYQSLQTIPL NPKEPWDREM DFDDSLTPEI RSEQLPEESI AEPQDSFDER  660
RTTAGAATTS SSQSGSSEPD LELLAALLKN PDLVYALTSG KPNNLVGQDM VKLLDVIKTG  720
VPNSNKKVEE KVEVSLPSPT PSTNPGMSGW GQEGIRNPFS RQIQVGAAVA RSSTQLHAAS  780
MQWQSTNDQS IPRHASPAYN SHTLPHTERQ QQQYMQPKLH HNQHLQQQQP ISTTSYTVRE  840
QVGQMGTATS SSWRSHQQNQ NSYYSHQANE IASASQASSY QGNNNNQYMS NNNPGFESWS  900
PDHSPSRNHP NMRGQQQQQQ PSRKHDSSST HPYWNQNKRW R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872830.10.0hypothetical protein ARALYDRAFT_911958
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A087GLV50.0A0A087GLV5_ARAAL; Luminidependens
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein